PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G37260.1
Common NameATMYB73, C7A10.100, MYB73
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 320aa    MW: 34848.7 Da    PI: 6.3762
Description myb domain protein 73
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G37260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.31e-191358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw + 
      AT4G37260.1 13 KGPWSPEEDDLLQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58
                     79******************************.***********985 PP

2Myb_DNA-binding54.13.7e-1767109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +++a++++G++ W+tI+r ++ gRt++ +k++w++ 
      AT4G37260.1  67 AFSQEEDETIIRAHARFGNK-WATISRLLN-GRTDNAIKNHWNST 109
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.985863IPR017930Myb domain
SuperFamilySSF466891.62E-3110106IPR009057Homeodomain-like
SMARTSM007179.4E-181261IPR001005SANT/Myb domain
PfamPF002499.2E-201358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-261466IPR009057Homeodomain-like
CDDcd001675.98E-171557No hitNo description
SMARTSM007172.8E-1464112IPR001005SANT/Myb domain
PROSITE profilePS5129420.29365114IPR017930Myb domain
PfamPF002491.4E-1467109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2267113IPR009057Homeodomain-like
CDDcd001671.63E-1167110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSNPTRKNME RIKGPWSPEE DDLLQRLVQK HGPRNWSLIS KSIPGRSGKS CRLRWCNQLS  60
PEVEHRAFSQ EEDETIIRAH ARFGNKWATI SRLLNGRTDN AIKNHWNSTL KRKCSVEGQS  120
CDFGGNGGYD GNLGEEQPLK RTASGGGGVS TGLYMSPGSP SGSDVSEQSS GGAHVFKPTV  180
RSEVTASSSG EDPPTYLSLS LPWTDETVRV NEPVQLNQNT VMDGGYTAEL FPVRKEEQVE  240
VEEEEAKGIS GGFGGEFMTV VQEMIRTEVR SYMADLQRGN VGGSSSGGGG GGSCMPQSVN  300
SRRVGFREFI VNQIGIGKME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-40101131104MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-40811453159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-40811453159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-40121133104C-Myb DNA-Binding Domain
1msf_C3e-40121133104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.569890.0flower| inflorescence| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246253_at0.0
Expression AtlasAT4G37260-
AtGenExpressAT4G37260-
ATTED-IIAT4G37260-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. AtMyb73 expression was upregulated by salt stress but not by other stresses. Accumulation of salt overly sensitive (SOS) transcripts, SOS1 and SOS3, was higher in atmyb73 ko and atmyb73 eko plants than in wild type plants receiving 300mM NaCl treatment.
    [PMID: 23809151]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G37260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G37260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615910.0AL161591.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 87.
GenBankAY0639120.0AY063912.1 Arabidopsis thaliana putative myb-related protein (At4g37260) mRNA, complete cds.
GenBankAY0912670.0AY091267.1 Arabidopsis thaliana putative myb-related protein (At4g37260) mRNA, complete cds.
GenBankAY5196130.0AY519613.1 Arabidopsis thaliana MYB transcription factor (At4g37260) mRNA, complete cds.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ997070.0Z99707.1 Arabidopsis thaliana DNA chromosome 4, ESSA I AP2 contig fragment No. 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195443.10.0myb domain protein 73
SwissprotQ9FDW13e-92MYB44_ARATH; Transcription factor MYB44
TrEMBLO231600.0O23160_ARATH; MYB transcription factor
STRINGAT4G37260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Oono Y, et al.
    Monitoring expression profiles of Arabidopsis gene expression during rehydration process after dehydration using ca 7000 full-length cDNA microarray.
    Plant J., 2003. 34(6): p. 868-87
    [PMID:12795706]
  4. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  5. Kasukabe Y, et al.
    Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(6): p. 712-22
    [PMID:15215506]
  6. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  7. Lee D,Polisensky DH,Braam J
    Genome-wide identification of touch- and darkness-regulated Arabidopsis genes: a focus on calmodulin-like and XTH genes.
    New Phytol., 2005. 165(2): p. 429-44
    [PMID:15720654]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  10. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  11. Peng M,Bi YM,Zhu T,Rothstein SJ
    Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA.
    Plant Mol. Biol., 2007. 65(6): p. 775-97
    [PMID:17885809]
  12. Ferreira FJ,Guo C,Coleman JR
    Reduction of plastid-localized carbonic anhydrase activity results in reduced Arabidopsis seedling survivorship.
    Plant Physiol., 2008. 147(2): p. 585-94
    [PMID:18434607]
  13. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  14. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  15. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  16. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  17. Kim JH, et al.
    Loss of the R2R3 MYB, AtMyb73, causes hyper-induction of the SOS1 and SOS3 genes in response to high salinity in Arabidopsis.
    J. Plant Physiol., 2013. 170(16): p. 1461-5
    [PMID:23809151]
  18. Zhao Y, et al.
    The ABA receptor PYL8 promotes lateral root growth by enhancing MYB77-dependent transcription of auxin-responsive genes.
    Sci Signal, 2014. 7(328): p. ra53
    [PMID:24894996]
  19. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]